Llanfairpwllgwyngyllgogerychwyrndrobwllllantysiliogogogoch




 
--
Boots
 
April 1st, 2005  
Xion
 

Topic: Llanfairpwllgwyngyllgogerychwyrndrobwllllantysilio gogogoch


The Welsh Village of "Llanfairpwllgwyngyllgogerychwyrndrobwllllantysili ogogogoch" , variously spelled with between 54 and 58 letters is credited with possessing the longest place name in Great Britain, and one of the longest in the world.

Often shortened to Llanfair P.G., the name translates roughly as "Saint Mary's church in the hollow of the white hazel near a rapid whirlpool by the red cave of Saint Tusilio"

-------------------------------------------------------------------------------------

Holy , I bit my tounge a 100 times trying to pronounce that in vain.

I read that in a map book I'm browsing through, just felt I might share it with you all

Does anyone from GB know more about this, I find this amazing

Just found this site
http://llanfairpwllgwyngyllgogerychw...ogogogoch.com/
April 1st, 2005  
CDTGaticaW201
 
That is just ridiculuous! I thought you were drunk and accidentally typed that.
April 1st, 2005  
Charge 7
 
 
Our cats must be Welsh. They type like that all the time.
--
Boots
April 1st, 2005  
CanadianCowgirl
 
 
I'd like to hear someone pronounce that, lol. I bet most people who live there can't spell it much less say it, lol
April 1st, 2005  
Charge 7
 
 
Spell it? Well maybe, but pronounce it most certainly. Gaelic is not dead by a long shot. Many speakers of the language still in Wales, Ireland and Scotland. Even some in Brittany (province of France).
April 1st, 2005  
CanadianCowgirl
 
 
Wow, it'd take awhile to say wouldn't it? lol, I thought he wrote that as the title just to catch people's attention, lol
April 1st, 2005  
AFSteliga
 
 
I've heard about that place before, however, I've never made an attempt to pronounce it.
April 5th, 2005  
Xion
 
Holy Hell , what about this one ?

Gorsafawddachaidraigodanheddogleddollonpenrhynareu rdraethceredigion

The Fairbourne & Barmouth Steam Railway was originally built in 1885 by Arthur McDougall
(of McDougall's flour) who made many Improvements and brought new locomotives to Fairbourne.
The old “golf halt” was renamed Gorsafawddachaidraigodanheddogleddollonpenrhynareu rdraethceredigion
as an attempt to get into the Guinness Book of Records by making it the station with the longest name.

And this one ....

And finally, sadly even the 67 character allowance for a .com domain name is still insufficient for the town of

Tetaumatawhakatangihangakoauaotamateaurehaeaturipu kapihimaungahoronukupokaiwhenuaakitanarahu

in New Zealand with a staggering 92 characters however even this seems positively tiny compared to the town of


And finally the daddy of all names..

Krungthepmahanakornamornratanakosinmahintarayuttha yamahadilokphopnopparatrajathaniburiromudomrajaniw esmahasatharnamornphimarnavatarnsathitsakkattiyavi sanukamprasit
... means city of angels
in Thailand which is a whopping 163 characters long ,However whilst
the New Zealand place name is recognised by the Guiness Book of Record, the Thailand name is not.
April 6th, 2005  
MontyB
 
 
Quote:
And finally, sadly even the 67 character allowance for a .com domain name is still insufficient for the town of

Tetaumatawhakatangihangakoauaotamateaurehaeaturipu kapihimaungahoronukupokaiwhenuaakitanarahu
Its a hill not a town.


Incidently the reason the Thai name is not recognised by the Guiness book of records is because it isn't used as an official indication of the city.
April 6th, 2005  
CABAL
 
 
Any particular reasons for tremendously long names? I believe that in some cases in several cultures, to have a longer name indicates great importance.